GPR89 monoclonal antibody (M01), clone 4D8
  • GPR89 monoclonal antibody (M01), clone 4D8

GPR89 monoclonal antibody (M01), clone 4D8

Ref: AB-H00051463-M01
GPR89 monoclonal antibody (M01), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GPR89.
Información adicional
Size 100 ug
Gene Name GPR89B
Gene Alias GPHR|GPR89|SH120
Gene Description G protein-coupled receptor 89B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPR89 (AAH03187, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51463
Clone Number 4D8
Iso type IgG2b Kappa

Enviar uma mensagem


GPR89 monoclonal antibody (M01), clone 4D8

GPR89 monoclonal antibody (M01), clone 4D8