REV1L polyclonal antibody (A01)
  • REV1L polyclonal antibody (A01)

REV1L polyclonal antibody (A01)

Ref: AB-H00051455-A01
REV1L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant REV1L.
Información adicional
Size 50 uL
Gene Name REV1
Gene Alias FLJ21523|MGC163283|MGC26225|REV1L
Gene Description REV1 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPGLSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen REV1L (NP_057400, 1097 a.a. ~ 1194 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51455

Enviar uma mensagem


REV1L polyclonal antibody (A01)

REV1L polyclonal antibody (A01)