PRRX2 monoclonal antibody (M01), clone 4C9
  • PRRX2 monoclonal antibody (M01), clone 4C9

PRRX2 monoclonal antibody (M01), clone 4C9

Ref: AB-H00051450-M01
PRRX2 monoclonal antibody (M01), clone 4C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRRX2.
Información adicional
Size 100 ug
Gene Name PRRX2
Gene Alias MGC19843|PMX2|PRX2
Gene Description paired related homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRRX2 (NP_057391.1, 151 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51450
Clone Number 4C9
Iso type IgG2b Kappa

Enviar uma mensagem


PRRX2 monoclonal antibody (M01), clone 4C9

PRRX2 monoclonal antibody (M01), clone 4C9