PRRX2 polyclonal antibody (A01)
  • PRRX2 polyclonal antibody (A01)

PRRX2 polyclonal antibody (A01)

Ref: AB-H00051450-A01
PRRX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRRX2.
Información adicional
Size 50 uL
Gene Name PRRX2
Gene Alias MGC19843|PMX2|PRX2
Gene Description paired related homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRRX2 (NP_057391, 110 a.a. ~ 202 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51450

Enviar uma mensagem


PRRX2 polyclonal antibody (A01)

PRRX2 polyclonal antibody (A01)