YTHDF2 purified MaxPab mouse polyclonal antibody (B01P)
  • YTHDF2 purified MaxPab mouse polyclonal antibody (B01P)

YTHDF2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051441-B01P
YTHDF2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human YTHDF2 protein.
Información adicional
Size 50 ug
Gene Name YTHDF2
Gene Alias HGRG8|NY-REN-2
Gene Description YTH domain family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen YTHDF2 (NP_057342.2, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51441

Enviar uma mensagem


YTHDF2 purified MaxPab mouse polyclonal antibody (B01P)

YTHDF2 purified MaxPab mouse polyclonal antibody (B01P)