PRKAG2 MaxPab rabbit polyclonal antibody (D01)
  • PRKAG2 MaxPab rabbit polyclonal antibody (D01)

PRKAG2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051422-D01
PRKAG2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKAG2 protein.
Información adicional
Size 100 uL
Gene Name PRKAG2
Gene Alias AAKG|AAKG2|CMH6|H91620p|WPWS
Gene Description protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP,IF
Immunogen Prot. Seq MLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAG2 (NP_077747.1, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51422

Enviar uma mensagem


PRKAG2 MaxPab rabbit polyclonal antibody (D01)

PRKAG2 MaxPab rabbit polyclonal antibody (D01)