NOL7 purified MaxPab mouse polyclonal antibody (B01P)
  • NOL7 purified MaxPab mouse polyclonal antibody (B01P)

NOL7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051406-B01P
NOL7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NOL7 protein.
Información adicional
Size 50 ug
Gene Name NOL7
Gene Alias C6orf90|MGC71933|PQBP3|RARG-1|dJ223E5.2
Gene Description nucleolar protein 7, 27kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOL7 (NP_057251, 1 a.a. ~ 257 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51406

Enviar uma mensagem


NOL7 purified MaxPab mouse polyclonal antibody (B01P)

NOL7 purified MaxPab mouse polyclonal antibody (B01P)