HSFX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSFX1 purified MaxPab rabbit polyclonal antibody (D01P)

HSFX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051402-D01P
HSFX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSFX1 protein.
Información adicional
Size 100 ug
Gene Name HSFX1
Gene Alias LW-1
Gene Description heat shock transcription factor family, X linked 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSFX1 (NP_057237.1, 1 a.a. ~ 423 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51402

Enviar uma mensagem


HSFX1 purified MaxPab rabbit polyclonal antibody (D01P)

HSFX1 purified MaxPab rabbit polyclonal antibody (D01P)