ANGPT4 monoclonal antibody (M01), clone 1B7
  • ANGPT4 monoclonal antibody (M01), clone 1B7

ANGPT4 monoclonal antibody (M01), clone 1B7

Ref: AB-H00051378-M01
ANGPT4 monoclonal antibody (M01), clone 1B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ANGPT4.
Información adicional
Size 100 ug
Gene Name ANGPT4
Gene Alias AGP4|ANG-3|ANG4|MGC138181|MGC138183
Gene Description angiopoietin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANGPT4 (NP_057069, 25 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51378
Clone Number 1B7
Iso type IgG2b Kappa

Enviar uma mensagem


ANGPT4 monoclonal antibody (M01), clone 1B7

ANGPT4 monoclonal antibody (M01), clone 1B7