ANGPT4 polyclonal antibody (A01)
  • ANGPT4 polyclonal antibody (A01)

ANGPT4 polyclonal antibody (A01)

Ref: AB-H00051378-A01
ANGPT4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ANGPT4.
Información adicional
Size 50 uL
Gene Name ANGPT4
Gene Alias AGP4|ANG-3|ANG4|MGC138181|MGC138183
Gene Description angiopoietin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANGPT4 (NP_057069, 25 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51378

Enviar uma mensagem


ANGPT4 polyclonal antibody (A01)

ANGPT4 polyclonal antibody (A01)