SNX7 purified MaxPab mouse polyclonal antibody (B01P)
  • SNX7 purified MaxPab mouse polyclonal antibody (B01P)

SNX7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051375-B01P
SNX7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNX7 protein.
Información adicional
Size 50 ug
Gene Name SNX7
Gene Alias DKFZp564F052|MGC8717
Gene Description sorting nexin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX7 (NP_689424.1, 1 a.a. ~ 336 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51375

Enviar uma mensagem


SNX7 purified MaxPab mouse polyclonal antibody (B01P)

SNX7 purified MaxPab mouse polyclonal antibody (B01P)