C2orf28 purified MaxPab mouse polyclonal antibody (B01P)
  • C2orf28 purified MaxPab mouse polyclonal antibody (B01P)

C2orf28 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051374-B01P
C2orf28 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C2orf28 protein.
Información adicional
Size 50 ug
Gene Name C2orf28
Gene Alias APR--3|APR-3|APR3|HSPC013|PRO240|p18
Gene Description chromosome 2 open reading frame 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C2orf28 (NP_057169.2, 1 a.a. ~ 171 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51374

Enviar uma mensagem


C2orf28 purified MaxPab mouse polyclonal antibody (B01P)

C2orf28 purified MaxPab mouse polyclonal antibody (B01P)