POMP purified MaxPab mouse polyclonal antibody (B02P)
  • POMP purified MaxPab mouse polyclonal antibody (B02P)

POMP purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051371-B02P
POMP purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POMP protein.
Información adicional
Size 50 ug
Gene Name POMP
Gene Alias C13orf12|HSPC014|PNAS-110|UMP1
Gene Description proteasome maturation protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POMP (NP_057016.1, 1 a.a. ~ 141 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51371

Enviar uma mensagem


POMP purified MaxPab mouse polyclonal antibody (B02P)

POMP purified MaxPab mouse polyclonal antibody (B02P)