TEX264 purified MaxPab rabbit polyclonal antibody (D01P)
  • TEX264 purified MaxPab rabbit polyclonal antibody (D01P)

TEX264 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051368-D01P
TEX264 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TEX264 protein.
Información adicional
Size 100 ug
Gene Name TEX264
Gene Alias DKFZp451H0417|FLJ13935|SIG11|ZSIG11
Gene Description testis expressed 264
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TEX264 (NP_057010.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51368

Enviar uma mensagem


TEX264 purified MaxPab rabbit polyclonal antibody (D01P)

TEX264 purified MaxPab rabbit polyclonal antibody (D01P)