ZMYND10 monoclonal antibody (M05), clone 3A6
  • ZMYND10 monoclonal antibody (M05), clone 3A6

ZMYND10 monoclonal antibody (M05), clone 3A6

Ref: AB-H00051364-M05
ZMYND10 monoclonal antibody (M05), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ZMYND10.
Información adicional
Size 100 ug
Gene Name ZMYND10
Gene Alias BLU|FLU
Gene Description zinc finger, MYND-type containing 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZMYND10 (AAH33732, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51364
Clone Number 3A6
Iso type IgG2b Kappa

Enviar uma mensagem


ZMYND10 monoclonal antibody (M05), clone 3A6

ZMYND10 monoclonal antibody (M05), clone 3A6