Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZBTB7A monoclonal antibody (M07), clone 2A2
Abnova
ZBTB7A monoclonal antibody (M07), clone 2A2
Ref: AB-H00051341-M07
ZBTB7A monoclonal antibody (M07), clone 2A2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant ZBTB7A.
Información adicional
Size
100 ug
Gene Name
ZBTB7A
Gene Alias
DKFZp547O146|FBI-1|FBI1|LRF|MGC99631|ZBTB7|ZNF857A|pokemon
Gene Description
zinc finger and BTB domain containing 7A
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA,IF
Immunogen Prot. Seq
MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZBTB7A (AAH19108, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
51341
Clone Number
2A2
Iso type
IgG2a Kappa
Enviar uma mensagem
ZBTB7A monoclonal antibody (M07), clone 2A2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*