NGRN purified MaxPab mouse polyclonal antibody (B01P)
  • NGRN purified MaxPab mouse polyclonal antibody (B01P)

NGRN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051335-B01P
NGRN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NGRN protein.
Información adicional
Size 50 ug
Gene Name NGRN
Gene Alias DSC92
Gene Description neugrin, neurite outgrowth associated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NGRN (AAH01682.1, 1 a.a. ~ 219 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51335

Enviar uma mensagem


NGRN purified MaxPab mouse polyclonal antibody (B01P)

NGRN purified MaxPab mouse polyclonal antibody (B01P)