ERAF polyclonal antibody (A01)
  • ERAF polyclonal antibody (A01)

ERAF polyclonal antibody (A01)

Ref: AB-H00051327-A01
ERAF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ERAF.
Información adicional
Size 50 uL
Gene Name ERAF
Gene Alias AHSP|EDRF
Gene Description erythroid associated factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERAF (NP_057717, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51327

Enviar uma mensagem


ERAF polyclonal antibody (A01)

ERAF polyclonal antibody (A01)