PHF21A polyclonal antibody (A01)
  • PHF21A polyclonal antibody (A01)

PHF21A polyclonal antibody (A01)

Ref: AB-H00051317-A01
PHF21A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PHF21A.
Información adicional
Size 50 uL
Gene Name PHF21A
Gene Alias BHC80|BM-006|KIAA1696
Gene Description PHD finger protein 21A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF21A (NP_057705, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51317

Enviar uma mensagem


PHF21A polyclonal antibody (A01)

PHF21A polyclonal antibody (A01)