ECSIT monoclonal antibody (M01), clone 1B8
  • ECSIT monoclonal antibody (M01), clone 1B8

ECSIT monoclonal antibody (M01), clone 1B8

Ref: AB-H00051295-M01
ECSIT monoclonal antibody (M01), clone 1B8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ECSIT.
Información adicional
Size 100 ug
Gene Name ECSIT
Gene Alias SITPEC
Gene Description ECSIT homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,PLA-Ce
Immunogen Prot. Seq TCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGIQSPDQQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ECSIT (AAH00193, 20 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51295
Clone Number 1B8
Iso type IgG2a Kappa

Enviar uma mensagem


ECSIT monoclonal antibody (M01), clone 1B8

ECSIT monoclonal antibody (M01), clone 1B8