CD320 polyclonal antibody (A01)
  • CD320 polyclonal antibody (A01)

CD320 polyclonal antibody (A01)

Ref: AB-H00051293-A01
CD320 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD320.
Información adicional
Size 50 uL
Gene Name CD320
Gene Alias 8D6|8D6A
Gene Description CD320 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD320 (NP_057663, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51293

Enviar uma mensagem


CD320 polyclonal antibody (A01)

CD320 polyclonal antibody (A01)