GMPR2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GMPR2 purified MaxPab rabbit polyclonal antibody (D01P)

GMPR2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051292-D01P
GMPR2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GMPR2 protein.
Información adicional
Size 100 ug
Gene Name GMPR2
Gene Alias MGC15084|MGC830
Gene Description guanosine monophosphate reductase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GMPR2 (NP_001002000.1, 1 a.a. ~ 348 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51292

Enviar uma mensagem


GMPR2 purified MaxPab rabbit polyclonal antibody (D01P)

GMPR2 purified MaxPab rabbit polyclonal antibody (D01P)