ANKMY1 purified MaxPab mouse polyclonal antibody (B01P)
  • ANKMY1 purified MaxPab mouse polyclonal antibody (B01P)

ANKMY1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051281-B01P
ANKMY1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANKMY1 protein.
Información adicional
Size 50 ug
Gene Name ANKMY1
Gene Alias DKFZp686D20155|DKFZp686L21237|FLJ20499|ZMYND13
Gene Description ankyrin repeat and MYND domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MEGAHASLSLEDEVSGAGSRQRPLEGKGGETPAAEEPGSLKNYAVFATRDVSAAPEKEEEEAEGPLRAQDLRESYIQLVQGVQEWQDGCMYQGEFGLNMKLGYGKFSWPTGESYHGQFYRDHCHGLGTYMWPDGSSFTGTFYLSHREGYGTMYMKTRLFQTHCHNDIVNLLLDCGADVNKCSDEGLTALSMCFLLHYPAQSFKPNVAERTIPEPQEPPKFPVVPILSSSFMDTNLESLYYEVNVPSQGSYELRPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANKMY1 (AAH73146.1, 1 a.a. ~ 720 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51281

Enviar uma mensagem


ANKMY1 purified MaxPab mouse polyclonal antibody (B01P)

ANKMY1 purified MaxPab mouse polyclonal antibody (B01P)