GOLM1 monoclonal antibody (M04), clone 3B10
  • GOLM1 monoclonal antibody (M04), clone 3B10

GOLM1 monoclonal antibody (M04), clone 3B10

Ref: AB-H00051280-M04
GOLM1 monoclonal antibody (M04), clone 3B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GOLM1.
Información adicional
Size 100 ug
Gene Name GOLM1
Gene Alias C9orf155|FLJ22634|FLJ23608|GOLPH2|GP73|PSEC0257|bA379P1.3
Gene Description golgi membrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51280
Clone Number 3B10
Iso type IgG1 Kappa

Enviar uma mensagem


GOLM1 monoclonal antibody (M04), clone 3B10

GOLM1 monoclonal antibody (M04), clone 3B10