GOLM1 polyclonal antibody (A01)
  • GOLM1 polyclonal antibody (A01)

GOLM1 polyclonal antibody (A01)

Ref: AB-H00051280-A01
GOLM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GOLM1.
Información adicional
Size 50 uL
Gene Name GOLM1
Gene Alias C9orf155|FLJ22634|FLJ23608|GOLPH2|GP73|PSEC0257|bA379P1.3
Gene Description golgi membrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51280

Enviar uma mensagem


GOLM1 polyclonal antibody (A01)

GOLM1 polyclonal antibody (A01)