IER5 polyclonal antibody (A01)
  • IER5 polyclonal antibody (A01)

IER5 polyclonal antibody (A01)

Ref: AB-H00051278-A01
IER5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IER5.
Información adicional
Size 50 uL
Gene Name IER5
Gene Alias MGC102760|SBBI48
Gene Description immediate early response 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IER5 (NP_057629, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51278

Enviar uma mensagem


IER5 polyclonal antibody (A01)

IER5 polyclonal antibody (A01)