TFDP3 monoclonal antibody (M01), clone 1F11
  • TFDP3 monoclonal antibody (M01), clone 1F11

TFDP3 monoclonal antibody (M01), clone 1F11

Ref: AB-H00051270-M01
TFDP3 monoclonal antibody (M01), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFDP3.
Información adicional
Size 100 ug
Gene Name TFDP3
Gene Alias CT30|E2F-like|HCA661|MGC161639
Gene Description transcription factor Dp family, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFDP3 (NP_057605, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51270
Clone Number 1F11
Iso type IgG2a Kappa

Enviar uma mensagem


TFDP3 monoclonal antibody (M01), clone 1F11

TFDP3 monoclonal antibody (M01), clone 1F11