PIPOX monoclonal antibody (M10), clone 3D1
  • PIPOX monoclonal antibody (M10), clone 3D1

PIPOX monoclonal antibody (M10), clone 3D1

Ref: AB-H00051268-M10
PIPOX monoclonal antibody (M10), clone 3D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIPOX.
Información adicional
Size 100 ug
Gene Name PIPOX
Gene Alias LPIPOX
Gene Description pipecolic acid oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA,IF
Immunogen Prot. Seq IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIPOX (AAH27622.1, 292 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51268
Clone Number 3D1
Iso type IgG2a Kappa

Enviar uma mensagem


PIPOX monoclonal antibody (M10), clone 3D1

PIPOX monoclonal antibody (M10), clone 3D1