MRPL51 monoclonal antibody (M09), clone 1H5
  • MRPL51 monoclonal antibody (M09), clone 1H5

MRPL51 monoclonal antibody (M09), clone 1H5

Ref: AB-H00051258-M09
MRPL51 monoclonal antibody (M09), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MRPL51.
Información adicional
Size 100 ug
Gene Name MRPL51
Gene Alias CDA09|HSPC241|MRP64|bMRP64
Gene Description mitochondrial ribosomal protein L51
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRPL51 (AAH00191, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51258
Clone Number 1H5
Iso type IgG2b Kappa

Enviar uma mensagem


MRPL51 monoclonal antibody (M09), clone 1H5

MRPL51 monoclonal antibody (M09), clone 1H5