MARCH2 polyclonal antibody (A01)
  • MARCH2 polyclonal antibody (A01)

MARCH2 polyclonal antibody (A01)

Ref: AB-H00051257-A01
MARCH2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MARCH2.
Información adicional
Size 50 uL
Gene Name MARCH2
Gene Alias HSPC240|MARCH-II|RNF172
Gene Description membrane-associated ring finger (C3HC4) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen 40970 (NP_057580, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51257

Enviar uma mensagem


MARCH2 polyclonal antibody (A01)

MARCH2 polyclonal antibody (A01)