RNF181 monoclonal antibody (M01), clone 5A7
  • RNF181 monoclonal antibody (M01), clone 5A7

RNF181 monoclonal antibody (M01), clone 5A7

Ref: AB-H00051255-M01
RNF181 monoclonal antibody (M01), clone 5A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF181.
Información adicional
Size 100 ug
Gene Name RNF181
Gene Alias HSPC238
Gene Description ring finger protein 181
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq IEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF181 (NP_057578, 90 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51255
Clone Number 5A7
Iso type IgG2a Kappa

Enviar uma mensagem


RNF181 monoclonal antibody (M01), clone 5A7

RNF181 monoclonal antibody (M01), clone 5A7