SHISA5 monoclonal antibody (M03), clone 3G5
  • SHISA5 monoclonal antibody (M03), clone 3G5

SHISA5 monoclonal antibody (M03), clone 3G5

Ref: AB-H00051246-M03
SHISA5 monoclonal antibody (M03), clone 3G5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SHISA5.
Información adicional
Size 100 ug
Gene Name SHISA5
Gene Alias SCOTIN|hShisa5
Gene Description shisa homolog 5 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SHISA5 (AAH01463, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51246
Clone Number 3G5
Iso type IgG2a Kappa

Enviar uma mensagem


SHISA5 monoclonal antibody (M03), clone 3G5

SHISA5 monoclonal antibody (M03), clone 3G5