MGC29506 purified MaxPab mouse polyclonal antibody (B02P)
  • MGC29506 purified MaxPab mouse polyclonal antibody (B02P)

MGC29506 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051237-B02P
MGC29506 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MGC29506 protein.
Información adicional
Size 50 ug
Gene Name MGC29506
Gene Alias FLJ32987|PACAP
Gene Description hypothetical protein MGC29506
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MGC29506 (NP_057543.2, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51237

Enviar uma mensagem


MGC29506 purified MaxPab mouse polyclonal antibody (B02P)

MGC29506 purified MaxPab mouse polyclonal antibody (B02P)