View larger
Mouse monoclonal antibody raised against a full-length recombinant GLRX5.
AB-H00051218-M04
New product
GLRX5 monoclonal antibody (M04), clone 4G8
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | GLRX5 |
| Gene Alias | C14orf87|FLB4739|GRX5|MGC14129|PR01238|PRO1238 |
| Gene Description | glutaredoxin 5 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GLRX5 (NP_057501.2, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 51218 |
| Clone Number | 4G8 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant GLRX5.