RAB9B purified MaxPab mouse polyclonal antibody (B01P)
  • RAB9B purified MaxPab mouse polyclonal antibody (B01P)

RAB9B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051209-B01P
RAB9B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB9B protein.
Información adicional
Size 50 ug
Gene Name RAB9B
Gene Alias RAB9L
Gene Description RAB9B, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB9B (NP_057454.1, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51209

Enviar uma mensagem


RAB9B purified MaxPab mouse polyclonal antibody (B01P)

RAB9B purified MaxPab mouse polyclonal antibody (B01P)