NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)
  • NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051203-B01P
NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NUSAP1 protein.
Información adicional
Size 50 ug
Gene Name NUSAP1
Gene Alias ANKT|BM037|FLJ13421|LNP|PRO0310p1|Q0310|SAPL
Gene Description nucleolar and spindle associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUSAP1 (NP_057443.1, 1 a.a. ~ 226 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51203

Enviar uma mensagem


NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)

NUSAP1 purified MaxPab mouse polyclonal antibody (B01P)