LEF1 monoclonal antibody (M08), clone 2E2
  • LEF1 monoclonal antibody (M08), clone 2E2

LEF1 monoclonal antibody (M08), clone 2E2

Ref: AB-H00051176-M08
LEF1 monoclonal antibody (M08), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LEF1.
Información adicional
Size 100 ug
Gene Name LEF1
Gene Alias DKFZp586H0919|TCF1ALPHA
Gene Description lymphoid enhancer-binding factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LEF1 (NP_057353, 33 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51176
Clone Number 2E2
Iso type IgG2b Kappa

Enviar uma mensagem


LEF1 monoclonal antibody (M08), clone 2E2

LEF1 monoclonal antibody (M08), clone 2E2