TUBE1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TUBE1 purified MaxPab rabbit polyclonal antibody (D01P)

TUBE1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051175-D01P
TUBE1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBE1 protein.
Información adicional
Size 100 ug
Gene Name TUBE1
Gene Alias FLJ22589|TUBE|dJ142L7.2
Gene Description tubulin, epsilon 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBE1 (NP_057346.1, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51175

Enviar uma mensagem


TUBE1 purified MaxPab rabbit polyclonal antibody (D01P)

TUBE1 purified MaxPab rabbit polyclonal antibody (D01P)