AADAT purified MaxPab rabbit polyclonal antibody (D01P)
  • AADAT purified MaxPab rabbit polyclonal antibody (D01P)

AADAT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051166-D01P
AADAT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AADAT protein.
Información adicional
Size 100 ug
Gene Name AADAT
Gene Alias KAT2|KATII
Gene Description aminoadipate aminotransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AADAT (AAH31068.1, 1 a.a. ~ 429 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51166

Enviar uma mensagem


AADAT purified MaxPab rabbit polyclonal antibody (D01P)

AADAT purified MaxPab rabbit polyclonal antibody (D01P)