DBR1 monoclonal antibody (M01), clone 3A7
  • DBR1 monoclonal antibody (M01), clone 3A7

DBR1 monoclonal antibody (M01), clone 3A7

Ref: AB-H00051163-M01
DBR1 monoclonal antibody (M01), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DBR1.
Información adicional
Size 100 ug
Gene Name DBR1
Gene Alias -
Gene Description debranching enzyme homolog 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DBR1 (NP_057300.2, 445 a.a. ~ 538 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51163
Clone Number 3A7
Iso type IgG2a Kappa

Enviar uma mensagem


DBR1 monoclonal antibody (M01), clone 3A7

DBR1 monoclonal antibody (M01), clone 3A7