DBR1 purified MaxPab mouse polyclonal antibody (B01P)
  • DBR1 purified MaxPab mouse polyclonal antibody (B01P)

DBR1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051163-B01P
DBR1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DBR1 protein.
Información adicional
Size 50 ug
Gene Name DBR1
Gene Alias -
Gene Description debranching enzyme homolog 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSGEKKAPVLTLFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECPPYNSSTIRSIYHVRNIEVYKLKQLKQPIDIFLSHDWPRSIYHYGNKKQLLKTKSFFRQEVENNTLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DBR1 (NP_057300.2, 1 a.a. ~ 544 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51163

Enviar uma mensagem


DBR1 purified MaxPab mouse polyclonal antibody (B01P)

DBR1 purified MaxPab mouse polyclonal antibody (B01P)