SERPINA10 monoclonal antibody (M02), clone 1E11
  • SERPINA10 monoclonal antibody (M02), clone 1E11

SERPINA10 monoclonal antibody (M02), clone 1E11

Ref: AB-H00051156-M02
SERPINA10 monoclonal antibody (M02), clone 1E11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SERPINA10.
Información adicional
Size 100 ug
Gene Name SERPINA10
Gene Alias PZI|ZPI
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINA10 (AAH22261, 22 a.a. ~ 444 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51156
Clone Number 1E11
Iso type IgG2a Kappa

Enviar uma mensagem


SERPINA10 monoclonal antibody (M02), clone 1E11

SERPINA10 monoclonal antibody (M02), clone 1E11