IRAK4 monoclonal antibody (M08), clone 3C10
  • IRAK4 monoclonal antibody (M08), clone 3C10

IRAK4 monoclonal antibody (M08), clone 3C10

Ref: AB-H00051135-M08
IRAK4 monoclonal antibody (M08), clone 3C10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant IRAK4.
Información adicional
Size 100 ug
Gene Name IRAK4
Gene Alias IPD1|NY-REN-64|REN64
Gene Description interleukin-1 receptor-associated kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRAK4 (NP_057207, 255 a.a. ~ 351 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51135
Clone Number 3C10
Iso type IgG2a Kappa

Enviar uma mensagem


IRAK4 monoclonal antibody (M08), clone 3C10

IRAK4 monoclonal antibody (M08), clone 3C10