IRAK4 polyclonal antibody (A01)
  • IRAK4 polyclonal antibody (A01)

IRAK4 polyclonal antibody (A01)

Ref: AB-H00051135-A01
IRAK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IRAK4.
Información adicional
Size 50 uL
Gene Name IRAK4
Gene Alias IPD1|NY-REN-64|REN64
Gene Description interleukin-1 receptor-associated kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKPAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRAK4 (AAH13316.1, 1 a.a. ~ 460 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51135

Enviar uma mensagem


IRAK4 polyclonal antibody (A01)

IRAK4 polyclonal antibody (A01)