RNF12 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant RNF12.

AB-H00051132-A01

New product

RNF12 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name RNF12
Gene Alias MGC15161|NY-REN-43|RLIM
Gene Description ring finger protein 12
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51132

More info

Mouse polyclonal antibody raised against a partial recombinant RNF12.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant RNF12.

Mouse polyclonal antibody raised against a partial recombinant RNF12.