RNF12 polyclonal antibody (A01)
  • RNF12 polyclonal antibody (A01)

RNF12 polyclonal antibody (A01)

Ref: AB-H00051132-A01
RNF12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF12.
Información adicional
Size 50 uL
Gene Name RNF12
Gene Alias MGC15161|NY-REN-43|RLIM
Gene Description ring finger protein 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51132

Enviar uma mensagem


RNF12 polyclonal antibody (A01)

RNF12 polyclonal antibody (A01)