GOLGA7 monoclonal antibody (M01), clone 2H8
  • GOLGA7 monoclonal antibody (M01), clone 2H8

GOLGA7 monoclonal antibody (M01), clone 2H8

Ref: AB-H00051125-M01
GOLGA7 monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GOLGA7.
Información adicional
Size 100 ug
Gene Name GOLGA7
Gene Alias GCP16|GOLGA3AP1|GOLGA7A|HSPC041|MGC21096|MGC4876
Gene Description golgi autoantigen, golgin subfamily a, 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51125
Clone Number 2H8
Iso type IgG2a Kappa

Enviar uma mensagem


GOLGA7 monoclonal antibody (M01), clone 2H8

GOLGA7 monoclonal antibody (M01), clone 2H8