GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)
  • GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)

GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051125-D01P
GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GOLGA7 protein.
Información adicional
Size 100 ug
Gene Name GOLGA7
Gene Alias GCP16|GOLGA3AP1|GOLGA7A|HSPC041|MGC21096|MGC4876
Gene Description golgi autoantigen, golgin subfamily a, 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GOLGA7 (AAH01227.1, 1 a.a. ~ 134 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51125

Enviar uma mensagem


GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)

GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)