RPL26L1 polyclonal antibody (A01)
  • RPL26L1 polyclonal antibody (A01)

RPL26L1 polyclonal antibody (A01)

Ref: AB-H00051121-A01
RPL26L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPL26L1.
Información adicional
Size 50 uL
Gene Name RPL26L1
Gene Alias FLJ46904|RPL26P1
Gene Description ribosomal protein L26-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL26L1 (NP_057177, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51121

Enviar uma mensagem


RPL26L1 polyclonal antibody (A01)

RPL26L1 polyclonal antibody (A01)