TFB1M purified MaxPab mouse polyclonal antibody (B02P)
  • TFB1M purified MaxPab mouse polyclonal antibody (B02P)

TFB1M purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051106-B02P
TFB1M purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TFB1M protein.
Información adicional
Size 50 ug
Gene Name TFB1M
Gene Alias CGI-75|CGI75|mtTFB|mtTFB1
Gene Description transcription factor B1, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFB1M (AAH17788.1, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51106

Enviar uma mensagem


TFB1M purified MaxPab mouse polyclonal antibody (B02P)

TFB1M purified MaxPab mouse polyclonal antibody (B02P)