C8orf70 purified MaxPab mouse polyclonal antibody (B01P)
  • C8orf70 purified MaxPab mouse polyclonal antibody (B01P)

C8orf70 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051101-B01P
C8orf70 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C8orf70 protein.
Información adicional
Size 50 ug
Gene Name FAM164A
Gene Alias C8orf70|CGI-62
Gene Description family with sequence similarity 164, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C8orf70 (ENSP00000263849, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51101

Enviar uma mensagem


C8orf70 purified MaxPab mouse polyclonal antibody (B01P)

C8orf70 purified MaxPab mouse polyclonal antibody (B01P)